PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa002937
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family Dof
Protein Properties Length: 263aa    MW: 29507.8 Da    PI: 8.7218
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58678656PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof115.22.7e-3647104360
     zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                ++ +kcprCdstntkfCyynny+ +qPr+fCkaC+r+WtkGG+lrnvPvGggr+++++
  Lsa002937  47 SDLVKCPRCDSTNTKFCYYNNYNKTQPRHFCKACKRHWTKGGTLRNVPVGGGRKNKRS 104
                5679**********************************************99766554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-2445103IPR003851Zinc finger, Dof-type
PfamPF027011.2E-3149103IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.39150104IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105288IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MGLSSKQVSG DHIELNWTQN MLTSDTIQSS SNPRSTTLKR SLPTQQSDLV KCPRCDSTNT  60
KFCYYNNYNK TQPRHFCKAC KRHWTKGGTL RNVPVGGGRK NKRSKRPNTT TTAATTTVDH  120
SLGFNGHKYM FPDDKGLFFK PNDSEFDQVS WDFNGGFTSS TTSMQPTPRQ SLGFSMLSNM  180
TSMDTTSIPI IPTSFSPLLS GFKDDSTLTT ARTMVQNSAT VSQPWMQAPT TSNFLESNYW  240
NWNDIDSIVD ESDLNKPFED PQV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A118JTE21e-128A0A118JTE2_CYNCS; Zinc finger, Dof-type
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.12e-31Dof family protein